PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG041010t1
Common NameTCM_041010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MYB
Protein Properties Length: 489aa    MW: 54035.2 Da    PI: 5.6153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG041010t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.2e-172875148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  Thecc1EG041010t1 28 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNSGLSRCGKSCRLRWANHL 75
                      79******************************************9986 PP

2Myb_DNA-binding537.7e-1781124146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g +T+eE+ ++++++++lG++ W++ a++++ gRt++++k++w++
  Thecc1EG041010t1  81 KGVFTPEEERRIIELHAKLGNK-WARMAAELP-GRTDNEIKNYWNT 124
                       789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0782375IPR017930Myb domain
SuperFamilySSF466892.55E-3026122IPR009057Homeodomain-like
SMARTSM007174.4E-152777IPR001005SANT/Myb domain
PfamPF002493.4E-152875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-242982IPR009057Homeodomain-like
CDDcd001672.11E-113075No hitNo description
PROSITE profilePS5129426.01976130IPR017930Myb domain
SMARTSM007173.1E-1680128IPR001005SANT/Myb domain
PfamPF002491.2E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2583128IPR009057Homeodomain-like
CDDcd001674.14E-1284124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MRKGHSDLSS VEEGSRRGSM RESCHLKKGP WTSAEDAILV DYVKKHGEGN WNAVQKNSGL  60
SRCGKSCRLR WANHLRPDLK KGVFTPEEER RIIELHAKLG NKWARMAAEL PGRTDNEIKN  120
YWNTRIKRLQ RAGLPIYPPD VCLQVNRSQE ESHNAASLPN GDSYASNLLQ SDAFEIPRVE  180
FENLELNQGC LSYSPMLHDI PANTMLKRVG SSYGYGLMFP IAHPTKRLRE SVSNYFSMPN  240
QLTENAYKKR FDGPLMISSP YDSNLSTNDQ ASFGIPPGSD APLNSNFSPS EPMSGPIKLE  300
LPSYQYSDTQ EDSWVNPAYP LPLVESVDNL IQSPSIEQAK SDYFTPQNSG LLEAVLHESQ  360
KLKSSKDDSC QQSSSTSVLD DVANFSLNHC EIEFEAHCDP NSPLAHSAAS VFSEFTPVSG  420
SSSDEPQFIE SILGCNAKNK TPSQMAVARL DDFIGPGQFG HNNGCVRDKP SMTDAIAALL  480
GEDPYCGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31261285106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015384.10.0Myb domain protein 33, putative isoform 1
SwissprotQ0JIC21e-99GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A061GU990.0A0A061GU99_THECC; Myb domain protein 33, putative isoform 1
STRINGPOPTR_0009s02380.11e-171(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.37e-85myb domain protein 33
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]